HORDB

ID: hor005571
Uniprot ID: P83627
Protein name: Vitellogenesis-inhibiting hormone
Gene name: NA
Organism: Armadillidium vulgare (Pillbug) (Pill woodlouse)
Family: arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum.
Disease: NA
Comments: NA
Taxonomy: Armadillidium (genus), Armadillidiidae (family), Crinocheta, Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE
Length: 83
Propeptide: YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-D2IT41-F1.pdb

hor005571_AF2.pdb

hor005571_ESM.pdb

Mass:	1095362	Formula:	C410H644N114O129S8
Absent amino acids:		Common amino acids:	DLS
pI:	5.05	Basic residues:	12
Polar residues:	29	Hydrophobic residues:	24
Hydrophobicity:	-35.54	Boman Index:	-17875
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	78.67
Instability Index:	4015.18	Extinction Coefficient cystines:	11835
Absorbance 280nm:	144.33

PubMed ID: 10480992
Title: Isolation and amino acid sequence of a peptide with vitellogenesis inhibiting activity from the terrestrial isopod Armadillidium vulgare (Crustacea).
PubMed ID: 12679090
Title: Localization of crustacean hyperglycemic and vitellogenesis-inhibiting hormones in separate cell types in the protocerebrum of the woodlouse Armadillidium vulgare (Crustacea, Isopoda).